SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008069 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000008069
Domain Number - Region: 424-504
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0349
Family PYP-like 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008069   Gene: ENSPPYG00000007138   Transcript: ENSPPYT00000008404
Sequence length 858
Comment pep:known_by_projection chromosome:PPYG2:16:17023238:17419053:-1 gene:ENSPPYG00000007138 transcript:ENSPPYT00000008404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAAPCARRLARRSHSALLADPHPSPLITLETQDGYFSHRPKEKVRTDSNNENSVPKDFE
NVDNSNFAPRTQKQKHQPELAKKLPSRQKELLKRKLEQQEKGKGHTFPGKGPGEVLPPGD
RAAANSSHGKDVSRLPHARKTGGSSPETKYDQPPKCDISGKEAISALSRAKSKHCRQEIG
ETYCRHKLGLLMPEKVTRFCPLEGKANKNVQWDEDSVEYMPANPVRIAFVLVVHGRASRQ
LQRMFKAIYHKDHFYYIHVDKRSNYLHRQVLQVSRQYSNVRVTPWRMATIWGGASLLSTY
LQSMRDLLEMTDWPWDFFINLSAADYPIRTNDQLVAFLSRYRDMNFLKSHGRDNARFIRK
QGLDRLFLECDAHMWRLGDRRIPEGIAVDGGSDWFLLNRRFVEYVTFSTDDLVTKMKQFY
SYTLLPAESFFHTVLENSPHCDTMVDNNLRITNWNRKLGCKCQYKHIVDWCGCSPNDFKP
QDFHRFQQTARPTFFARKFEAVVNQEIIGQLDYYLYGNYPAGTPGLRSYWENVYDEPDGI
HSLSDVTLTLYHSFARLGLRRAETSLHTDGENSCRYYPMGHPASVHLYFLADRFQGFLIK
HHATNLAVSKLETLETWVMPKKVFKIASPPSDFGRLQFSEVGTDWDAKERLFRNFGGLLG
PMDEPVGMQKWGKGPNVTVTVIWVDPVNVIAATYDILIESTAEFTHYKPPLNLPLRPGVW
TVKILHHWVPVAETKFLVAPLTFSNRQPIKPEEALKLHNGPLRNAYMEQSFQSLNPVLSL
PISPAQVEQARRNAASTGTALEGWLDSLVGGMWTAMDICATGPTACPVMQTCSQTAWSSF
SPDPKSELGAVKPDGRLR
Download sequence
Identical sequences H2NQ89
ENSPPYP00000008069 ENSPPYP00000008069 9600.ENSPPYP00000008069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]