SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008137 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008137
Domain Number 1 Region: 568-853
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-54
Family Protein kinases, catalytic subunit 0.00056
Further Details:      
 
Domain Number 2 Region: 88-300
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000000000379
Family Quinoprotein alcohol dehydrogenase-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008137   Gene: ENSPPYG00000007196   Transcript: ENSPPYT00000008472
Sequence length 974
Comment pep:known_by_projection chromosome:PPYG2:16:22837482:22859895:-1 gene:ENSPPYG00000007196 transcript:ENSPPYT00000008472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRAGIGEDSRLGLQAQPGAESSPGRAGTERSLGGTEGPGQPCSCPGAMASAARGSRPWT
RLGLQLQFAALLLGTLSPQVHTLRPESLLLVSTLDGSLHALSKQTGDLKWTLRDDPVIQG
PMYVTEMAFLSDPADGSLYMLGTQKQQGLMKLPFTIPELVHASPCRSSDGVFYTGRKQDA
WFVVDPESGETQMTLTTEGPSTPRLYIGRTQYTVTMHDPRAPALRWNTTYRRYSAPPMDG
SPGKYMSHLASCGMGLLLTVDPGNGTVLWTQDLGVPVMGVYTWHQDGLRQLPHLTLARDT
LHFLALRWGHIRLPASGPQDAATLFSALDTQLLMTLYVGKDETGFYVSKALVHTGVALVP
RGLTLAPADGPTTDEVTLQVSGEREGSPSTAVRYPSGSVALPSQWLLIGHHELPPVLHTT
MLRVHPTPGSGTAETRPPENTQAPAFFLELLSLSREKLWDSELHPEEKTPDYYLGLGPQD
LLAASLTAVLLGGWILFVMRQQQPQVVEKQQETPLASADSAHISQDAQSLNSGATRRSQK
RLQSPSKQAQPLDDPEAEQLTVVGKISFNPKDVLGRGAGGTFVFRGQFEGRAVAVKRLLR
ECFGLVRREVQLLQESDRHPNVLRYFCTERGPQFHYIALELCQASLQEYVENPDLDRGGL
EPEVVLQQLMSGLAHLHSLHIVHRDLKPGNILITGPDSQGLGRVVLSDFGLCKKLPAGRC
SFSLHSGIPGTEGWMAPELLQLLPPDSPTSAVDIFSAGCVFYYVLSGGSHPFGDSLYRQA
NILTGAPCLAHLEEEVHDKVVARDLVGAMLSPLPQPRPSAPQVLAHPFFWSRAKQLQFFQ
DVSDWLEKESEQEPLVRALEAGGCAVVRDNWHKHISMPLQTDLRKFRSYKGTSVRDLLRA
VRNKKHHYRELPVEVRQALGQVPDGFVRYFTNRFPQLLLHTHQAMRSCASESLFLPYYPP
DSEARRPCPGAAGR
Download sequence
Identical sequences H2NQF3
ENSPPYP00000008137 ENSPPYP00000008137 9600.ENSPPYP00000008137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]