SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008253 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008253
Domain Number 1 Region: 2-273
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.42e-61
Family Eukaryotic proteases 0.0003
Further Details:      
 
Domain Number 2 Region: 293-523
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.57e-51
Family Eukaryotic proteases 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008253   Gene: ENSPPYG00000007305   Transcript: ENSPPYT00000008592
Sequence length 553
Comment pep:known_by_projection chromosome:PPYG2:16:29621445:29626444:-1 gene:ENSPPYG00000007305 transcript:ENSPPYT00000008592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKWCWGPVLLIAGATVLMEGLQAAQRACGQRGPGPPKPQEGNTVPGEWPWQASVRRQGAH
ICSGSLVADTWVLTAAHCFEKAAATELNSWSVVLGSLQREGFSPGAEEVGVAALQLPRAY
NHYSQGSDLALLQLAHPTTHTPLCLPQPAHRFPFGASCWATGWDQDTSDAAGTLRNLRLR
LISRPTCNCIYNQLHQRHLSNPARPGMLCGGPQPGVQGPCQGDSGGPVLCLEPDGHWVQA
GIISFASSCAQEDAPVLLTNTAAHSSWLQARVQGAAFLAQSLETPEMSDEDSCVACGSLR
TAGPQAGAPSPWPWDARLMHQGQLACGGALVSEEAVLTAAHCFIGRQAPEEWSVGLGTRP
EEWGLKQLILHGAYTHPEGGYDVALLLLAQPVTLGASLRPLCLPYADHHLPDAERGWVLG
RARPGAGISSLQTVPVTLLGPKACSRLHAAPGGDGSPILPGMVCTSTVGELPSCEGLSGA
PLVHEVRGTWFLAGLHSFGDACQGPARPAVFTALPAYEDWVSSLDWQVYFAEEPEPEAEP
GSCLANMSQPASC
Download sequence
Identical sequences H2NQR8
XP_002826415.1.23681 ENSPPYP00000008253 9600.ENSPPYP00000008253 ENSPPYP00000008253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]