SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008258 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008258
Domain Number 1 Region: 6-264
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.42e-77
Family Eukaryotic proteases 0.0000919
Further Details:      
 
Domain Number 2 Region: 300-530
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.01e-35
Family Eukaryotic proteases 0.00045
Further Details:      
 
Domain Number 3 Region: 575-784
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.64e-32
Family Eukaryotic proteases 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008258   Gene: ENSPPYG00000007310   Transcript: ENSPPYT00000008597
Sequence length 829
Comment pep:known_by_projection chromosome:PPYG2:16:29676209:29686837:-1 gene:ENSPPYG00000007310 transcript:ENSPPYT00000008597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQHLLLPLVMLDCGRREPSARIVGSNAQPGTWPWQVSLHHGGGHICGGSLIASWVLSAA
HCFMTNGTLEPAAEWSVLLGVHSQDGPLDGAHTRAVAAIVVPANYSQVELGADLALLRLA
SPASLGPAVWPVCLPRASHRFVHGTACWATGWGDVQEADPLPLPWVLQEVKLRLLGKATC
QCLYSQPGPFNLTLQILPGMLCAGYPEGRRDTCQGDSGGPLVCEEGGRWFQAGITSFGFG
CGRRNRPGVFTAVATYEAWIREQVMGSEPGPAFPTQPQKTQSDPQEPREENCTIALPECG
NAPRPGAWPWEAQVMVPGSRPCHGALVSESWVLAPASCFLDPSSSDSPPRDLDAWRVLLP
SRPRAERVARLVQHENASWDNASDLALLHLRTPVNLSATPRPVCLPHPEHYFLPGSRCRL
ARWGRGEPALGPGALLEAELLGGWWCHCLYGRQGATVPLPGDPPHALCPAYQEEEEVGSC
WNDSRWSLLCQEEGTWFLAGIRDFPSGCLRPRAFFPLQTHGPWISHVTRGAYLEDQLAWD
WGPDGEETETQTCPPHTEHGACGLRLEAAPVGVLWPWLAEVHVAGDRVCTGILLAPGWVL
AATHCVLRPGSTTVPYIEVYLGRAGASSLPQGHQVSRLVISIRLPRHLGLRPPLALLELS
YRVEPSPSALPICLHPAGIPPGASCWVLGWKEPQDRVPVAAAVSILTQRICHCLYQGILP
PGTLCVLYAEGQENRCEMTSAPPLLCQTTEGFWVLVGMAVQGSRELFAAIGPEEAWISQT
VGEAHFLPPSGSPHWPTGGSNLCPPELARASGSPRAVHFLLLLTLLIQS
Download sequence
Identical sequences H2NQS3
9600.ENSPPYP00000008258 ENSPPYP00000008258 ENSPPYP00000008258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]