SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008311 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008311
Domain Number 1 Region: 361-559
Classification Level Classification E-value
Superfamily Hemopexin-like domain 9.16e-69
Family Hemopexin-like domain 0.00000000185
Further Details:      
 
Domain Number 2 Region: 112-182,296-349
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.77e-39
Family Matrix metalloproteases, catalytic domain 0.00000361
Further Details:      
 
Domain Number 3 Region: 236-292
Classification Level Classification E-value
Superfamily Kringle-like 1.6e-21
Family Fibronectin type II module 0.0000635
Further Details:      
 
Domain Number 4 Region: 178-233
Classification Level Classification E-value
Superfamily Kringle-like 6e-21
Family Fibronectin type II module 0.0000526
Further Details:      
 
Domain Number 5 Region: 42-107
Classification Level Classification E-value
Superfamily PGBD-like 2.67e-19
Family MMP N-terminal domain 0.0000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008311   Gene: ENSPPYG00000007357   Transcript: ENSPPYT00000008651
Sequence length 559
Comment pep:known_by_projection chromosome:PPYG2:16:42672523:42698235:1 gene:ENSPPYG00000007357 transcript:ENSPPYT00000008651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEALMSRGALTGTLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGC
PKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWD
KNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWALFT
MGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVG
GNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVA
AHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTL
GPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKID
AVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTY
IFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGSGHSYFFKGAYYLKLE
NQSLKSVKFGSIKSDWLGC
Download sequence
Identical sequences H2NQX4
ENSPPYP00000008311 9600.ENSPPYP00000008311 ENSPPYP00000008311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]