SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008369 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008369
Domain Number 1 Region: 24-267
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.42e-44
Family Eukaryotic proteases 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008369   Gene: ENSPPYG00000007406   Transcript: ENSPPYT00000008710
Sequence length 394
Comment pep:known_by_projection chromosome:PPYG2:16:45467704:45482515:-1 gene:ENSPPYG00000007406 transcript:ENSPPYT00000008710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSAAGLSGDGKMRGVLLVLLGLLYSSTSCGVQKASVFYGDPKEGLVSSMEFPWVVSLQD
SQYTHLAFGCILSEFWVLSIASAIQNRKDIVVIVGISNMDPSKIAHTEYPVDTIIIHEDF
DNNSMSNNIALLKTDTAMHFGNLVQSICFLGRMLHTPPVLQNCWVSGWNPTSATGNHMTM
SVLRKIFVKDLDMCPLHKLQKTECGSHTKEETKTACLGDPGSPMMCQLQQFDLWVLRGVL
NFGGETCPGLFLYTKVEDYSKWITSKAERAGPPLSSLHHWEKLTSFSHHGPNAAMTQKTY
SDSELGHVGSYLQGQRRTITHSRLGNSSRDSLDVREKGVKESGRSPEVSVQPLYYDYYGG
EVGEGRIFAGQNRLHQPEEIILVSFVLVFFCSSI
Download sequence
Identical sequences H2NR26
9600.ENSPPYP00000008369 ENSPPYP00000008369 ENSPPYP00000008369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]