SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008471 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008471
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily Pre-PUA domain 4.9e-43
Family Nip7p homolog, N-terminal domain 0.00000175
Further Details:      
 
Domain Number 2 Region: 95-170
Classification Level Classification E-value
Superfamily PUA domain-like 8.84e-27
Family PUA domain 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008471   Gene: ENSPPYG00000007503   Transcript: ENSPPYT00000008817
Sequence length 180
Comment pep:known chromosome:PPYG2:16:56748216:56753047:1 gene:ENSPPYG00000007503 transcript:ENSPPYT00000008817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISG
DKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGR
ITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT
Download sequence
Identical sequences A0A2J8VVJ9 G2HH83 G3RX93 I7GDL3 Q5R9J1 Q9Y221
ENSGGOP00000020429 GO.35113 HR2118 9598.ENSPTRP00000046864 9600.ENSPPYP00000008471 9606.ENSP00000254940 gi|7705437|ref|NP_057185.1| ENSP00000254940 ENSPPYP00000008471 NP_001125922.1.23681 NP_001233354.1.37143 NP_001270742.1.63531 NP_057185.1.87134 NP_057185.1.92137 XP_003814602.1.60992 XP_004057927.1.27298 ENSPTRP00000046864 ENSPPYP00000008471 ENSPTRP00000046864 ENSP00000254940 ENSGGOP00000020429 ENSP00000254940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]