SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008491 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008491
Domain Number 1 Region: 93-360
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.83e-58
Family Eukaryotic proteases 0.00012
Further Details:      
 
Domain Number 2 Region: 47-109
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000659
Family Complement control module/SCR domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008491   Gene: ENSPPYG00000007518   Transcript: ENSPPYT00000008837
Sequence length 361
Comment pep:known chromosome:PPYG2:16:59745564:59750862:-1 gene:ENSPPYG00000007518 transcript:ENSPPYT00000008837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHSTALPEARPTKMSALGAVIALLLWGQLFAVDSGNDVMDISDDGCPKPPQIAHGYVEH
SVRYQCKNYYRLRTEGDGVYTLNSEKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGG
HLDAKGSFPWQAKMVSRHNLTTGATLINEQWLLTTAKNLFLNHSENATVKDIAPTLTLYV
GKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVPVNERVMPICLPSKDYAEVGRVGYVSGWG
RNANFKFTDHLKYVMLPVADQDQCVRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSK
YQEDTCYGDAGSAFAVHDLEEDTWYAAGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAK
N
Download sequence
Identical sequences H2NRE0
ENSPPYP00000008491 ENSPPYP00000008491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]