SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008493 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008493
Domain Number 1 Region: 745-849
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 3.91e-28
Family Lipoxigenase N-terminal domain 0.024
Further Details:      
 
Domain Number 2 Region: 31-138
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000000489
Family C-type lectin domain 0.015
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000008493
Domain Number - Region: 1424-1483,1521-1643
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000235
Family Voltage-gated potassium channels 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008493   Gene: ENSPPYG00000007521   Transcript: ENSPPYT00000008840
Sequence length 1697
Comment pep:known_by_projection chromosome:PPYG2:16:59806735:59887784:1 gene:ENSPPYG00000007521 transcript:ENSPPYT00000008840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFFKGGSWLWLYIRTSIILGSELNSPSPHGQNNCYQLNRFQCSFEEAERYCHVQRGFLAH
IGNKEVQDLIRDYLEEGKKWWIGQNVMPLKKHQDNKYPADVAAHGPPKPPSCTYLSRNFI
RISSKEDKCLLKYYFICQTGDFLDGDAHYERNGNNSHLYPRHKKTKKGVAIARDKMPPEP
GHPPTTCHYPLPAHLSKTLCHPISPFPSVLPSITSQVTSATSEPSSQPLPVITQLTTPMS
VTHAGQSLAETTSSPKEEAHPNTFTSYLQVSLQNASGQVIDEIAGNFSRAVHGLQAHNKL
QEACEFLQKLIALTPRFSKPAQVNLINSLVYLSEELLRIPFQNNDSLGFKVPATVCPFHS
FNNVTKAGEGSWLESKRDTEQVEDILEMSLVEFGNIGEAFLEQNQSPESSVTLTSSIATL
LLSRQNISTLPMSSYTLGHPAPVRLGFPSVSALKELLNKHPGVNVQITGLAFNPFKDLDN
RNIVGSIGSVLLSADRKLLQVHDLMEDIEIMLWRNVSVETYPTSLNMSTRQLTITVNLTS
LEKSLIVSIDPDSPLLMTLYLGFQYQPNCTHFHLNITLPKDKVWQKDEEYTWVLTPEQLQ
HGIGTYYITAVLNERQEGAQQTPSLVSVITAVTQCYYWEIHNQTWSNTGCQVGPQSTILR
TQCLCNHLTFFASDFFVVPRTVNVEDTIELFLRVTNNPVGVSLLASLLGFYVITVVWAWK
KDQADMQKVKVTVLADNDPSAQFHYLIQVYTGYRRRAATTAKVVITLYGSEGRSEPHHLC
DPQKAVFERGGLDVFLLTTWSSLGDLHSLRLWHDNSGVSPSWYVSQVIVCDMAVKRKWHF
LCNCWLAVDLGDCELDRVFIPVSKRELFSFRHLFSSMIVEKFTQDYLWLSVATRHPWNQF
TRVQRLSCCMTLLLCNMVINVMFWKRNSTTAKRDEQMGPFAVAWSELLISIHTAVILFPI
NLVIGRLFPLIEPQETLPLFPPIQASCLSDASVEPLSATMVVEELKETVRFLLRRNTYLL
SKCEQPPWSSRDITKLVKLLSNLISSHLEGQGCHQQGERHWARVVPENHHHFCCYLRRVL
QRLKPHLGMLGLTQGHQSCDFLDAASQLQKLQELLETHILPTEQEPSREVTSFAILSSEE
GKKPMSNGLSKWLTSVCWLLLGLTSLASAFFTALYSLELSKDQATSWMISIILSVLQNVF
ISQPVKKCSSSVPGSRDKNNPVYVAPAMNSPTKRPERTLKKKKLFKLTGDILVQILFLTL
LMTAIYSAKNSNRFYLHQAIWKTFSHQFSEIKLLQDFYPWANHILLPSLYGDYRGKNAVL
EPSHCKCGVQLIFQIPHTKTYEKVEEGQLAFSDGHTCGHPKSLFPGLHLRRFSYICSPRP
MALIPTDGLHKSLTSKNENGFSYIMRSAFFTSVRLESFTSLQMSKKGFVWSIISQVIYYL
LVCYYAFIQGCRLKQQKWRFFTGKRNILDTSIILISFILLGLDMKSISLHKKNMARYRDD
QDRFINFYEAVKVNSAATHLVGFLVLLATVQLWNLLHHSPRLRVISSTLSRAWDEVVGFL
LIILILLTGYAIAFNLLFGCSISDYRTFFSSAVTVVGLLMGISHQEEVFALDPVLGTFLI
LTSVILMVLVVINLFVSAILTAFGKERKSLKKEAALIDMLLQKLSNFLGISRPQKTSSEQ
AAATAMSSDTEALDELP
Download sequence
Identical sequences H2NRE2
9600.ENSPPYP00000008493 ENSPPYP00000008493 ENSPPYP00000008493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]