SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008530 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008530
Domain Number 1 Region: 11-210
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.26e-70
Family Eukaryotic proteases 0.000000458
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008530   Gene: ENSPPYG00000007557   Transcript: ENSPPYT00000008878
Sequence length 219
Comment pep:novel chromosome:PPYG2:16:62528313:62534607:-1 gene:ENSPPYG00000007557 transcript:ENSPPYT00000008878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFLWLLSCDKTGFHFCGGSLISEDWVVTAAHCGVRTSHVVVVGEFDQGSDEENIQVLKI
AKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTK
YNANKTPDKLQQATLPLLSNAECKKSWGRRITDVMICAGASGISSCKGDSGGPLVCQKDG
AWTLVGIVSWGSHTCSTTTPAVYAHVTKLIPVQKILAAN
Download sequence
Identical sequences H2NRH9
9600.ENSPPYP00000008530 ENSPPYP00000008530 ENSPPYP00000008530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]