SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008531 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008531
Domain Number 1 Region: 8-190
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.42e-62
Family Eukaryotic proteases 0.0000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008531   Gene: ENSPPYG00000007558   Transcript: ENSPPYT00000008879
Sequence length 192
Comment pep:known_by_projection chromosome:PPYG2:16:62565382:62568641:1 gene:ENSPPYG00000007558 transcript:ENSPPYT00000008879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGVPTIHPVLSGLSRIVNGEDAIPGSWPWQVSLQVFKNPKFSILTVNNDITLLKLATPAR
FSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQATLPLLSNAECKKFWG
RKITDVMICAGASGVSSCMGDSGGPLVCQKDGAWTLVGIVSWGSDTCSTSSPGVYARVTK
LIPWVQQILAAN
Download sequence
Identical sequences H2NRI0
9600.ENSPPYP00000008531 ENSPPYP00000008531 ENSPPYP00000008531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]