SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008561 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008561
Domain Number 1 Region: 11-156
Classification Level Classification E-value
Superfamily C-type lectin-like 4.2e-28
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 2 Region: 275-341
Classification Level Classification E-value
Superfamily PKD domain 0.0000523
Family PKD domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000008561
Domain Number - Region: 547-606
Classification Level Classification E-value
Superfamily Clathrin adaptor appendage domain 0.000785
Family gamma-adaptin C-terminal appendage domain-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008561   Gene: ENSPPYG00000007586   Transcript: ENSPPYT00000008909
Sequence length 639
Comment pep:novel chromosome:PPYG2:16:68822245:68870150:-1 gene:ENSPPYG00000007586 transcript:ENSPPYT00000008909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAVGLVLLVLALRLRATTAKPEDGSSCSKSQVAFRDACYEFVPLGRTFRNAQSWCEGQG
GHLVFIQDEGTQWFLQKHISQDREWWIGLTWNLARNGTTEGPGSWLDTSNVTYSNWHGGQ
ATAAPDTCGHIGRGPSSEWVASECAQTFAFVCEFRVGQTLACKGLNATMHCGSGQVIQVQ
DAVYGRQNPHFCTQDAGHPSDLEQGCSWANIKDEVAGQCQGLQACQVAADETYFGNLCPT
QGSYLWVQYQCREALQLMVSSESFIFDNVTISLAWLLSPYIGNLSCIISTGDGHTFDPYN
PPSVSSNVTHQFTSPGEFTVFAECTTSEWPVTAQRQVTVQDKMERLSVTACSGLSQSGAG
PLCQAVFGDPLWIQVELDGCERNCRPVNASEDILLRVTMGEGSPVAMFSWYLDNTPTEQA
DSLPDACRLRGFWPRSLTLLQSNTSMLLLNSSFLQSWGEVIRIRATALTRHAYGEDTYVI
STLPPPEVPACTIAPEEGTVLTSFAIFCNASTALGPLEFCFCLESGSCLHCGPEPVLPSV
YLPLGKENNDFVLTVVISATNRAGDTQQTQAVAKVALGDTCVEDVAFQAAVSEKVPTALQ
GKGGPEQLLQLAKAVSSVLNQEHESQGSGQSLSMDVRQK
Download sequence
Identical sequences H2NRL0
9600.ENSPPYP00000008561 ENSPPYP00000008561 ENSPPYP00000008561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]