SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008612 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008612
Domain Number 1 Region: 89-314
Classification Level Classification E-value
Superfamily Carbonic anhydrase 3.27e-82
Family Carbonic anhydrase 0.00000000902
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008612   Gene: ENSPPYG00000007634   Transcript: ENSPPYT00000008960
Sequence length 323
Comment pep:known_by_projection chromosome:PPYG2:16:75556386:75615056:-1 gene:ENSPPYG00000007634 transcript:ENSPPYT00000008960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFYKKEVGTRQSTVVLIKVRTDSREHHPLQIGVSGNKPKMLGRNTWKTSAFSLVEQMWV
PLWSRSMRPGRWCSQHSCARRTSNNTLHPLWTGPVSVPGGTRQSPINIQWRDSVYDPRLK
PLRVSYDAASCLYVWNTGYLFQVEFDDATEVSGISGGPLENHYRLKQFHFHWGAENEGGS
EHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKDARAAMPPFDPSTLLP
TCWDYWTYAGSLTTPPLTESATWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYR
PLQPLMNRKVWASFQATNEGTRS
Download sequence
Identical sequences H2NRR0
ENSPPYP00000008612 ENSPPYP00000008612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]