SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008673 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008673
Domain Number 1 Region: 6-243
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.45e-64
Family Eukaryotic proteases 0.0000195
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008673   Gene: ENSPPYG00000007694   Transcript: ENSPPYT00000009026
Sequence length 246
Comment pep:novel chromosome:PPYG2:16_random:1767048:1768837:1 gene:ENSPPYG00000007694 transcript:ENSPPYT00000009026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LHTLSPQMLLLLLFLAVSSLGSYSSGSPVPVPENDLVGIVGGHNAPQGKWPWQVSLRIYN
YHWASWVHICGGSLIHPQWVLTAAHCIFQKDTDPSTYRIHAGDVYLYGGRGQLNVSRIIV
HPNYVTAGLGADVALLQLASPVICAANVRTVKLSPVSLELTPKDRCWVTGWGAIRMFESL
PPPYRLRQVSVQVLENAICEQRYRNASGHTGDRQLILDDMLCAGSEGRDSCYGDSGGPLV
CRLRGS
Download sequence
Identical sequences H2NRW9
9600.ENSPPYP00000008673 ENSPPYP00000008673 ENSPPYP00000008673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]