SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008702 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008702
Domain Number 1 Region: 15-209
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.75e-60
Family Eukaryotic proteases 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008702   Gene: ENSPPYG00000007719   Transcript: ENSPPYT00000009056
Sequence length 236
Comment pep:known_by_projection chromosome:PPYG2:16_random:7782294:7785251:1 gene:ENSPPYG00000007719 transcript:ENSPPYT00000009056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTALFSSTSYGDLSNPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLSPHYLGNSPYD
IALVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPYTLQEVQVA
IINNSMCNHLFLKYSFHKDIFGDMVCAGNAQGGKDACFGDSGGPLACNKNGLWYQIGVVS
WGVGCGRPNRPGVYTNISHHFEWIQKMMAQSGMSQPDPSWPLLFLPLLWALPLLGP
Download sequence
Identical sequences H2NRZ7
ENSPPYP00000008702 9600.ENSPPYP00000008702 ENSPPYP00000008702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]