SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008723 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008723
Domain Number 1 Region: 11-192
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.62e-61
Family Eukaryotic proteases 0.000000406
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008723   Gene: ENSPPYG00000007739   Transcript: ENSPPYT00000009080
Sequence length 192
Comment pep:novel chromosome:PPYG2:16_random:10961101:10962535:1 gene:ENSPPYG00000007739 transcript:ENSPPYT00000009080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCGVPAIHPVLSGLSRIVNGEDAIPGSWPWQVSLQDKTGFHFCGGSLISEDWVVTAAHCG
VRTSDVVVVGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVS
AVCLPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQATLPLLSNAECKKSWGRRITDV
MICAGASGISSC
Download sequence
Identical sequences H2NS16
9600.ENSPPYP00000008723 ENSPPYP00000008723 ENSPPYP00000008723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]