SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008732 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008732
Domain Number 1 Region: 1-278
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.07e-85
Family Eukaryotic proteases 0.0000000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008732   Gene: ENSPPYG00000007748   Transcript: ENSPPYT00000009089
Sequence length 282
Comment pep:known chromosome:PPYG2:16_random:11943690:11946078:1 gene:ENSPPYG00000007748 transcript:ENSPPYT00000009089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLAPQMLSLLLLALPVLVSPAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGQ
YWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIVMHPQF
YIIQTGADIALLELEEPVNISSNVHTVTLPLASETFPAGTPCWVTGWGDVDNNVRLPPPY
PLKEVEVPIVENHICDAEYHTGLHTGDSFQIVRDDMLCAGSEKHDSCQGDSGGPLVCKVN
GTWLQAGVVSWDESCAQPNRPGIYTRVTYYLDWIHRYVPKKP
Download sequence
Identical sequences H2NS25
ENSPPYP00000008732 ENSPPYP00000008732 NP_001189430.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]