SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008733 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008733
Domain Number 1 Region: 6-239
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.87e-56
Family Eukaryotic proteases 0.0000183
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008733   Gene: ENSPPYG00000007749   Transcript: ENSPPYT00000009090
Sequence length 242
Comment pep:novel chromosome:PPYG2:16_random:11948862:11950650:-1 gene:ENSPPYG00000007749 transcript:ENSPPYT00000009090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LHTLSPQMLLLLLFLAVSSLGSYSSGSPVPVPENDLVGIVGGHNAPQGKWPWQVSLRIYN
YHWASWVHICGGSLIHPQWVLTAAHCIFQKDTDPSTYRIHAGDVYLYGGRGQLNVSRIIV
HPNYVTAGLGADVALLQLEPRDLCNVRTVKLSPVSLELTPKDRCWVTGWGAIIKKESLPP
PYRLQQVSVQVLENAICEQRYRNASGHTGDRQLILDDMLCAGSEGRDSGDSGGPLVCRLR
GS
Download sequence
Identical sequences H2NS26
9600.ENSPPYP00000008733 ENSPPYP00000008733 ENSPPYP00000008733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]