SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008762 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008762
Domain Number 1 Region: 244-307
Classification Level Classification E-value
Superfamily RILP dimerisation region 2.09e-17
Family RILP dimerisation region 0.0000296
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000008762
Domain Number - Region: 80-125
Classification Level Classification E-value
Superfamily BLRF2-like 0.0458
Family BLRF2-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008762   Gene: ENSPPYG00000007776   Transcript: ENSPPYT00000009120
Sequence length 400
Comment pep:known_by_projection chromosome:PPYG2:17:1507398:1511040:-1 gene:ENSPPYG00000007776 transcript:ENSPPYT00000009120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPRRAAPGAPGWGSREAAGSGMAAELVYHLAGALGTELQDLARRFGPEAAAGLVPLVVR
ALELLEQAAVGPAPESLQVSAQQAEQELRRLREENERLRRDLRAGPQEERALLRQLKEVT
DRQRDELRAHNRDLRQRGQESEALQEQLQRLLLVNAELRHKLAAVQTQLRAAQDRERERQ
QPGEAATPQAKERAREQAGRPGHQHGQEPEWATAGAGAPGNPEDSVEAAQQLGCPSEAGQ
CRFSREEFEQILQERNELKAKVFLLKEELAYFQRELLTDHRVPGLLLEAMKVAVRKQRKK
IKAKMLGTPEEAESSGDEDGSWLLLSDDKGDHPPTPESKIQSFFGLWYRGKAESSEDETS
SPAPSKLGGEEAQPQSPAPDPPCSALHEHLFLGASAAPEA
Download sequence
Identical sequences H2NS55
ENSPPYP00000008762 XP_002826855.1.23681 9600.ENSPPYP00000008762 ENSPPYP00000008762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]