SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008882 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008882
Domain Number 1 Region: 159-307
Classification Level Classification E-value
Superfamily C-type lectin-like 1.52e-44
Family C-type lectin domain 0.0000025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008882   Gene: ENSPPYG00000007894   Transcript: ENSPPYT00000009246
Sequence length 316
Comment pep:known_by_projection chromosome:PPYG2:17:7086413:7092959:-1 gene:ENSPPYG00000007894 transcript:ENSPPYT00000009246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRTYENFQCLENEEKVQGFKNGPPPLQSLLQHLRSGPCLLLLSLGLGLLLLVIICVVGF
QNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGLKQERQAGVS
ELQEHTKQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLNKLTCQVATLNNNASTEGTC
CPVSWVEHQDSCYWFSRSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQEHLGSTYTWMG
LSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGMWNDDVCQKPY
HWVCEAGLGQTSQESH
Download sequence
Identical sequences H2NSH1
9600.ENSPPYP00000008882 XP_002826982.1.23681 ENSPPYP00000008882 ENSPPYP00000008882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]