SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008883 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008883
Domain Number 1 Region: 152-250
Classification Level Classification E-value
Superfamily C-type lectin-like 1.43e-30
Family C-type lectin domain 0.0000394
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008883   Gene: ENSPPYG00000007895   Transcript: ENSPPYT00000009247
Sequence length 283
Comment pep:known_by_projection chromosome:PPYG2:17:7113565:7128485:-1 gene:ENSPPYG00000007895 transcript:ENSPPYT00000009247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKDFQDIQQLSSEENDHPFHRGEGPGTRGLNPRRGNPFSKGPPPAQPLAQRLCSMVRFS
LLALSFNILLLVVICVIGSQSAQLQAELRSLKEAFSNFSSSTLMEVHALSTHGGGMGDKI
TSLGAKLEKQQQDLKADHDALLFHLKHFPVDLRFVACQLELLHSNGSQRTCCPVNWEEHQ
GSCYWFSHSGKAWAEAEKYCQLENAHLVVINSWEEQKFIVQHTNPFNTWIGLTDSDGSWK
WVDGTDYRHNYKCTAGCVRRGGMPPARRPDPSTPLANPYPTPA
Download sequence
Identical sequences H2NSH2
ENSPPYP00000008883 ENSPPYP00000008883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]