SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008884 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008884
Domain Number 1 Region: 129-281
Classification Level Classification E-value
Superfamily C-type lectin-like 2.45e-41
Family C-type lectin domain 0.000000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008884   Gene: ENSPPYG00000007896   Transcript: ENSPPYT00000009248
Sequence length 291
Comment pep:known chromosome:PPYG2:17:7185480:7190723:-1 gene:ENSPPYG00000007896 transcript:ENSPPYT00000009248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKEYQDLQHLDNEESDHHQLRKGPPPSQPLLQRLCSGPRLLLLSLGLSLLLLVVVCVIG
SQNSQLQKELRGLRETFSNFTASTEAQVKGLSTQGGNVGRKMKSLESQLEKQQKDLSEDH
SSLLLHVKQFVSDLRSLSCQMAALQGNGSERACCPVNWVEHERSCYWFSRSGKAWADADN
YCRLEDAHLVVVTSWEEQKFVQHHTGPVNTWMGLHDQNGPWKWVDGTDYETGFKNWRPEQ
PDDWYGHGLGGGEDCAHFTDDGRWNDDVCQRPYRWVCETELDKASQEPPLL
Download sequence
Identical sequences H2NSH3
9600.ENSPPYP00000008884 ENSPPYP00000008884 ENSPPYP00000008884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]