SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009024 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009024
Domain Number 1 Region: 4-93
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.00000000602
Family Ypt/Rab-GAP domain of gyp1p 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009024   Gene: ENSPPYG00000008024   Transcript: ENSPPYT00000009390
Sequence length 131
Comment pep:novel chromosome:PPYG2:17:17135917:17139292:1 gene:ENSPPYG00000008024 transcript:ENSPPYT00000009390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHPDKEGLCTQGSSFSWLLRMLNVGISLGLTLRLWDMHLLEGEQMLMPITSTAFKVQRSL
YEETNKEVWGPATPRALKGTGGARPICESLHSSLQVLTASESSRGPSLLQTPPRVPGQQA
LSQGDKGISVS
Download sequence
Identical sequences H2NSV8
9600.ENSPPYP00000009024 ENSPPYP00000009024 ENSPPYP00000009024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]