SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009320 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009320
Domain Number 1 Region: 5-46
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000675
Family G proteins 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009320   Gene: ENSPPYG00000008294   Transcript: ENSPPYT00000009696
Sequence length 48
Comment pep:novel chromosome:PPYG2:17:43187602:43187748:1 gene:ENSPPYG00000008294 transcript:ENSPPYT00000009696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAAEITDKLGLHSLRYRNWHIQATCATTGHGLYEGLNWLANQFQSQN
Download sequence
Identical sequences H2NTP6
ENSPPYP00000009320 ENSPPYP00000009320 9600.ENSPPYP00000009320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]