SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009443 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009443
Domain Number 1 Region: 222-387,419-481
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.72e-38
Family Voltage-gated potassium channels 0.0036
Further Details:      
 
Domain Number 2 Region: 484-677
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.69e-32
Family cAMP-binding domain 0.00069
Further Details:      
 
Domain Number 3 Region: 39-135
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.49e-25
Family Flavin-binding PAS domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009443   Gene: ENSPPYG00000008397   Transcript: ENSPPYT00000009822
Sequence length 1017
Comment pep:known_by_projection chromosome:PPYG2:17:47266028:47288114:1 gene:ENSPPYG00000008397 transcript:ENSPPYT00000009822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVMKGLLAPQNTFLDTIATRFDGTHSNFLLANAQGTRGFPIVYCSDGFCELTGYGRTEV
MQKTCSCRFLYGPETSEPALQRLHKALEGHQEHRAEICFYRKDGSAFWCLLDMMPIKNEM
GEVVLFLFSFKDITQSGSPGLGPQGGRGDSNHENSLGRRGATWKFRSARRRSRTVLHRLT
GHFGRRGQGGMKANNNVFEPKPSVPEYKVASVGGSRCLLLHYSVPKAIWDGLILLATFYV
AVTVPYNVCFSGDDDTPITSRHTLVSDIAVEMLFILDIILNFRTTYVSQSGQVISAPRSI
GLHYLATWFFIDLIAALPFDLLYVFNITVTSLVHLLKTVRLLRLLRLLQKLERYSQCSAV
VLTLLMSVFALLAHWMACIWYVIGRREMEANDPLLWDIGWLHELGKRLEVPYVNGSVGGP
SRRSAYIAALYFTLSSLTSVGFGNVCANTDAEKIFSICTMLIGALMHAVVFGNVTAIIQR
MYSRRSLYHSRMKDLKDFIRVHRLPRPLKQRMLEYFQTTWAVNSGIDANELLRDFPDELR
ADIAMHLNREILQLPLFGAASRGCLRALSLHIKTSFCAPGEYLLRRGDALQAHYYVCSGS
LEVLRDNMVLAILGKGDLIGADIPEPGQEPGLGADPSFVLKTSADVKALTYCGLQQLSSQ
GLAEVLRLYPEYGAAFRAGLPRDLTFNLRQGSDTSGLSRFSRSPRLSQPRSESLGSSSDK
TLPSITEAESGAEPGGGPRPRRPLLLPNLSPARPRGSLVSLLGDELPPFSALVSSPSLSP
SLSPALAGQGHSASPHGPPRCSAAWKPPQLLIPPLGTFGPPDLSPRIVDGIEDSGSTAEA
PSFRFSRRPELPRPRSQAPPTGTRPSPELASEAEEVKEKVCRLNQEISRLNQEVSQLSRE
LRHIMGLLQARLGPPGHPAGSAWTPDPPCPQLRPPCLSPCASRPPPSLQDTTLAEVHCPA
SVGTMETGTALLDLRPSILPPYPSEPDPLGPSPVPEASPPTPSLLRHSFQSRSDTFH
Download sequence
Identical sequences H2NU13
XP_009250020.1.23681 9600.ENSPPYP00000009443 ENSPPYP00000009443 ENSPPYP00000009443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]