SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009564 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009564
Domain Number 1 Region: 23-283
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.28e-82
Family Carbonic anhydrase 0.000000000282
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009564   Gene: ENSPPYG00000008512   Transcript: ENSPPYT00000009945
Sequence length 312
Comment pep:known_by_projection chromosome:PPYG2:17:51267448:51280734:1 gene:ENSPPYG00000008512 transcript:ENSPPYT00000009945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWMLLALLALSAARPSASAESHWCYEVQAESSNYRCLVPAKWGGNCQKDRQSPINIVTTK
AKVDKRLGHFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPARYQATQLHLHWSN
SLRNGSEHSLNGEYFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGPQVNEGF
RPLVEALSNVPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFQE
PIQLHREQILAFSQKLYYDKEQTLSMKDNVRPLQQPGQRAVMKSGAPGQPLPWALPALLG
PMLACLLAGFLQ
Download sequence
Identical sequences H2NUC9
9600.ENSPPYP00000009564 ENSPPYP00000009564 ENSPPYP00000009564 XP_002827723.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]