SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009570 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009570
Domain Number 1 Region: 376-507
Classification Level Classification E-value
Superfamily C-type lectin-like 5.91e-42
Family C-type lectin domain 0.0000893
Further Details:      
 
Domain Number 2 Region: 235-368
Classification Level Classification E-value
Superfamily C-type lectin-like 1.92e-37
Family C-type lectin domain 0.00042
Further Details:      
 
Domain Number 3 Region: 850-1000
Classification Level Classification E-value
Superfamily C-type lectin-like 8.27e-34
Family C-type lectin domain 0.00041
Further Details:      
 
Domain Number 4 Region: 718-843
Classification Level Classification E-value
Superfamily C-type lectin-like 2.65e-30
Family C-type lectin domain 0.00044
Further Details:      
 
Domain Number 5 Region: 1146-1286
Classification Level Classification E-value
Superfamily C-type lectin-like 2.82e-27
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 6 Region: 571-702
Classification Level Classification E-value
Superfamily C-type lectin-like 9.62e-27
Family C-type lectin domain 0.00086
Further Details:      
 
Domain Number 7 Region: 41-173
Classification Level Classification E-value
Superfamily Ricin B-like lectins 5.07e-26
Family Cysteine rich domain 0.0047
Further Details:      
 
Domain Number 8 Region: 1016-1142
Classification Level Classification E-value
Superfamily C-type lectin-like 1.2e-24
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 9 Region: 172-230
Classification Level Classification E-value
Superfamily Kringle-like 1.2e-20
Family Fibronectin type II module 0.00087
Further Details:      
 
Domain Number 10 Region: 517-562
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000000000304
Family C-type lectin domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009570   Gene: ENSPPYG00000008519   Transcript: ENSPPYT00000009952
Sequence length 1369
Comment pep:known_by_projection chromosome:PPYG2:17:52290998:52356465:1 gene:ENSPPYG00000008519 transcript:ENSPPYT00000009952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGRPAPAPWPRHLLCCVLLLGGLHLGRPGAPGDAALPEPNVFLIFSHGLQGCLEAQGG
QVRVTPACNTSLPAQRWKWVSRNRLFNLGTMQCLGTGWPGTNTTASLGMYECDREALNLR
WHCRTLGDQLSLLLGARTSNISKPGTLERGDQTRSGQWRIYGSEEDLCALPYHEVYTIQG
NSHGKPCTIPFKYDNQWFHGCTSTGREDGHLWCATTQDYGKDERWGFCPIKSNDCETFWD
KDQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYSSTLWIGL
NDLDRSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRDCSIALPYVCK
KKPNATAEPTPPDRWANVKVECEPSWQPFQGHCYRLQAEKRSWQESKKACLRGGGDLVSI
HSMAELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLED
CVTIWGPEGRWNDSPCNQSLPSICKKAGQLSQGPAEEDHGCRKGWTWHSPSCYWLGEDQV
TYSEARRLCTDHGSQLVTITNRGWASDPKLRYCYKVFSSERLQDKKSWVQAQGACQELGA
QLLSLASYEEEHFVANMLNKIFGESEPEIHEQHWFWIGLNRRDPRGGQSWRWSDGVGFSY
HNFDRSRHDDDDIRGCAVLDLASLQWVAMQCDTQLDWICKIPRGTDVREPDDSPQGRREW
LRFQEAEYKFFEHHSTWAQAQRICTWFQAELTSVHSQEELDFLGHNLQKFSRAQEQHWWI
LHTSESDGRFRWTDGSIINFISWAPGKPRPVGKDKKCVYMTASREDWGDQRCLTALPYIC
KRSNITKETQPPDLPTTALGGCPSGWIQFLNKCFQVQGQDPQSRVKWSEAQFSCEQQEAQ
LVTITNPLEQAFITASLPNVTFDLWIGLHASQRDFQWVEQEPLMYANWAPGEPSGPSPAP
SGNKPTSCAVVLHSPSAQFTGRWDDRSCTEETHGFICQKGTDASLSPSPAALPPAPGTEL
SYLNGTFRLLQKPLRWHDALLLCESRNASLAYVPDPYTQAFLTQAARGLRTPLWIGLAGE
EGSRRYSWVSEEPLNYVGWQDGEPQQPGGCTYVDVDGAWRTTSCDTKLQGAVCGVSSGPP
PPRRISYHGSCPQGLADSAWIPFREHCYSFHMELLLGHKEARQRCQRAGGAVLSILDEME
NVFVWEHLQSYEGQSRGAWLGMNFNPKGGTLVWQDNTAVNYSNWGPPGLGPSMLSHNSCY
WIQSNSGLWRPGACTNITMGVVCKLPRAEQSSFSPSALPENPAALVVVLMAVLLLLALLT
AALILYRRRQSIERGAFEGARYSRSSSSPTEATEKNILVSDMEMNEQQE
Download sequence
Identical sequences H2NUD5
9600.ENSPPYP00000009570 ENSPPYP00000009570 ENSPPYP00000009570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]