SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009667 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009667
Domain Number 1 Region: 138-367
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.14e-52
Family C-terminal domain of adrenodoxin reductase-like 0.00000000587
Further Details:      
 
Domain Number 2 Region: 37-197
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2.94e-19
Family N-terminal domain of adrenodoxin reductase-like 0.00000875
Further Details:      
 
Domain Number 3 Region: 336-495
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.0000000447
Family N-terminal domain of adrenodoxin reductase-like 0.000000628
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009667   Gene: ENSPPYG00000008607   Transcript: ENSPPYT00000010052
Sequence length 496
Comment pep:known_by_projection chromosome:PPYG2:17:64863761:64874340:-1 gene:ENSPPYG00000008607 transcript:ENSPPYT00000010052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRCWRWWGLSAWPRTRLPPAGSTPSFRHHFSTQEKTPQICVVGSGPAGFYTAQHLLKH
PQAHVDIYEKQPVPFGLVRFGVAPDHPEVKNVINTFTQTAHSGRCFWGNVEVGRDVTVPE
LREAYHAVVLSYGAEDHRALEIPGEELPGVFSARAFVGWYNGLPENQELEPDLSCDTAVI
LGQGNVALDVARILLTPPEHLEALLLCQRTDITKAALGVLRQSRVKTVWLVGRRGPLQVA
FTIKELREMIQLPGARPILDPADFLGLQDKIKEVPRPRKRLTELLFRTATEKPGPEEAVR
QASASRAWGLRFFRSPQQVLPSPDGRRAAGVRLAVTRLEGVDEATRAVPTGDIEDLPCGL
VLSSIGYKSRPVDPSVPFDSKLGVIPNVEGRVMDVPGLYCSGWVKRGPTGVIATTMTDSF
LTGQMLLQDLKAGLLPSGPRPGYAAIQALLSSRGVQPVSFSDWEKLDAEEVARGQGTGKP
REKLVDPQEMLRLLGH
Download sequence
Identical sequences H2NUN0
ENSPPYP00000009667 9600.ENSPPYP00000009667 ENSPPYP00000009667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]