SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009763 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009763
Domain Number 1 Region: 21-130
Classification Level Classification E-value
Superfamily SRCR-like 2.62e-28
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00000552
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000009763
Domain Number - Region: 136-247
Classification Level Classification E-value
Superfamily POZ domain 0.00018
Family BTB/POZ domain 0.034
Further Details:      
 
Domain Number - Region: 418-499
Classification Level Classification E-value
Superfamily UBC-like 0.00377
Family UBC-related 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009763   Gene: ENSPPYG00000008699   Transcript: ENSPPYT00000010154
Sequence length 594
Comment pep:known_by_projection chromosome:PPYG2:17:69030638:69036323:-1 gene:ENSPPYG00000008699 transcript:ENSPPYT00000010154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPRLFWVWLLVAGTPSVNDGDMRLADGGATNQGRVESFYRGQWGTVCDNLWEPDCIAS
VVCRDPGLLRTATQRLLPSAVSTGSGPIMLDEVQCMGTEASLADCKSLGWLKSNCRHERD
AGVVCTNETRSTHTLDLSRELSEALGQIFDSQRGCDLSISVSVQGEDALGFCGHTVILTA
NPEAQALWKEPGSNVTMSVHAECVPMVRDFLRYFYSRRIDIALSSVKCFHKLASAYGAKQ
LQGYCASLFAILLPRDPSFQTPLDLYAYAVATGDALLEKLCLQFLAWNFEALTQAEAWPS
VPTTLLQLLLPRATWAVPQRSWALLKAVDHLDPGGERRLPNEEVEGLGVEKIRFPMMLPE
ELFELQFNLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPRIYTSPTW
SASVTDSSLRVHSAQLIYQSQTGSLWSKYFFLTYFQAPSDYRISSPYRSFQTPPHPSFLF
QDKRVSWSLVYLPTIQSCWNYGFSCSSDELPVLGLTKAGGSDRTIAYENKALMLCEGLFV
ADVTDFEGWKSAIPSALDTNSSKSTSSFPCPAGHFNSFRTVVRPFYLTNSSGVD
Download sequence
Identical sequences H2NUX2
9600.ENSPPYP00000009763 ENSPPYP00000009763 ENSPPYP00000009763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]