SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009778 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009778
Domain Number 1 Region: 349-522,556-720
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.85e-86
Family YicI catalytic domain-like 0.00082
Further Details:      
 
Domain Number 2 Region: 105-347
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 5.02e-41
Family YicI N-terminal domain-like 0.0058
Further Details:      
 
Domain Number 3 Region: 723-819
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00000000000000288
Family Putative glucosidase YicI, domain 3 0.0073
Further Details:      
 
Domain Number 4 Region: 76-136
Classification Level Classification E-value
Superfamily Trefoil 0.000000000000497
Family Trefoil 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009778   Gene: ENSPPYG00000008713   Transcript: ENSPPYT00000010169
Sequence length 952
Comment pep:known chromosome:PPYG2:17:70148330:70167211:1 gene:ENSPPYG00000008713 transcript:ENSPPYT00000010169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVRHPPCSRRLLAICALVSLATAALLGHILLHDFLLVPRELSGSSPVLEETHPAHQQGA
SRPGPRDAQAHLGRPRAVPTQCDVPPNSRFDCAPDKAITREQCDARGCCYIPAKQGLRGA
QMGQPWCFFPPSYPSYKLENLSSSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLH
FTIKDPANRRYEVPLETPRVHSRAPSPLYSVEFSEEPFGVIVRRQLDGRVLLNTTVAPLF
FADQFLQLSTSLPSQYITGLAEHLSPLMLSTSWTRVTLWNRDLAPTPGANLYGSHPFYLA
LEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVRQYLDVVGY
PFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDTRRDFTFNKDG
FRDFPAMVRELHQGGRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITNETSQPLIGKV
WPGSTAFPDFTNPAALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCPDNELEN
PPYVPGVVGGTLQAATICASSHQFLSTHYNLHNLYGLTEAIASHRALVKARGTRPFVISR
STFAGHGRYAGHWTGDVWSSWEQLASSVPEILQFNLLGVPLVGADVCGFLGNTSEELCVR
WTQLGAFYPFMRNHNGLFNLPQEPYSFSEPAQQAMRKALTLRYALLPHLYTLFHQAHVAG
ETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLGTWYDLQTVPI
EALGSLPPPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESRQQP
MALAVALTKGGEARGELFWDDGESLEVLERGAYTQVLFLARNNTIVNELVHVTSEGAGLQ
LQKVTVLGVATAPQQVLSNGVPVSNFTYSPDTKVLDIPVSLLMAEQFLISWS
Download sequence
Identical sequences H2NUY7
XP_009250383.1.23681 ENSPPYP00000009778 ENSPPYP00000009778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]