SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010158 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010158
Domain Number 1 Region: 656-792
Classification Level Classification E-value
Superfamily C-type lectin-like 1.47e-42
Family C-type lectin domain 0.00016
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000010158
Domain Number - Region: 278-484
Classification Level Classification E-value
Superfamily Tropomyosin 0.00248
Family Tropomyosin 0.012
Further Details:      
 
Domain Number - Region: 146-253
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0759
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010158   Gene: ENSPPYG00000009048   Transcript: ENSPPYT00000010562
Sequence length 800
Comment pep:known_by_projection chromosome:PPYG2:18:32229179:32414879:1 gene:ENSPPYG00000009048 transcript:ENSPPYT00000010562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGSAGSAGRRRRGRTRAQTAGARRGYHGRAVSSRSGRLPRLRGARAELTGWRCVPTVTMK
DDFAEEEEVQSFGYKRFGIQEGTQCTKCKNNWALKFSIILLYILCALLTITVAILGYKVV
EKMDNVTGGMETSRQTYDDKLTAVESDLKKLGDQTGKKAISTNSELSTFRSDILDLRQQL
REITEKTSKNKDTLEKLQASGDALVDRQSQLKETLENNSFLITTVNKTLQAYNGYVTNLQ
QDTSVLQGNLQNQMYSHNVVIMNLNNLNLTQVQQRNLITNLQRSVDDTSQAIQRIKNDFQ
NLQQVFLQAKKDTDWLKEKVQSLQTLAANNSALAKANNDTLEDMNSQLNSFTGQMENIST
ISQANEQNLKDLQDLHKDAENRTAIKFNQLEERFQLFETDIVNIISNISYTAHHLRTLTS
NLNEVRTTCTDTLTKHTDDLTSLNNTLANIRLDSVSLRMQQDLMRSRLDTEVANLSVIME
EMKLVDSKHGQLIKNFTILQGPPGPRGPKGDRGSQGPPGPTGNKGQKGEKGEPGPPGPAG
ERGPIGPAGPPGERGGKGSKGSQGPKGSRGSPGKPGPQGPSGDPGPPGPPGKEGLPGPQG
PPGFQGLQGTVGEPGVPGPRGLPGLPGVPGMPGPKGPPGPPGPSGAVVPLALQNEPTPAP
EDNGCPPHWKNFTDKCYYFSVEKEIFEDAKLFCEDKSSHLVFINTREEQQWIKKQMVGRE
SHWIGLTDSERENEWKWLDGTSPDYKNWKAGQPDNWGHGHGPGEDCAGLIYAGQWNDFQC
EDVNNFICEKDRETVLSSAL
Download sequence
Identical sequences H2NW01
ENSPPYP00000010158 9600.ENSPPYP00000010158 ENSPPYP00000010158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]