SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010230 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010230
Domain Number 1 Region: 95-421
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.88e-69
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.00000000000626
Further Details:      
 
Domain Number 2 Region: 425-553
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.29e-37
Family Ricin B-like 0.000000566
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010230   Gene: ENSPPYG00000009109   Transcript: ENSPPYT00000010635
Sequence length 559
Comment pep:known_by_projection chromosome:PPYG2:18:47761387:47819661:1 gene:ENSPPYG00000009109 transcript:ENSPPYT00000010635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKFAYCKVVLATSLIWVLLDMFLLLYFSECNKCDEKKERGLPAGDVLEPVQKPHEGPGE
MGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSV
VIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHV
IRMEQRSGLIRARLKGAAVSKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDV
ISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDR
DYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQ
IINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRVGLRHKLQCKPFSWYLENIYP
DSQIPRHYFSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDD
LCLDVSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATDVYSQVPSIRDC
NVSLSQQWLLRNVTLPEIF
Download sequence
Identical sequences H2NW70
ENSPPYP00000010230 ENSPPYP00000010230 9600.ENSPPYP00000010230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]