SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010423 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010423
Domain Number 1 Region: 23-263
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.75e-69
Family Eukaryotic proteases 0.0000577
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010423   Gene: ENSPPYG00000009286   Transcript: ENSPPYT00000010836
Sequence length 283
Comment pep:known_by_projection chromosome:PPYG2:19:516900:527108:-1 gene:ENSPPYG00000009286 transcript:ENSPPYT00000010836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGLGGWGHPLLTVATALMLPVKPPAGSWGAQIIGGHEVTPHSRPYMASVHFGGQHHCG
GFLLRARWVVSAAHCFSHRNLRTGLVVLGAHNLRTVEPTQQVFGIDAVTMHPDYHPMTHA
NDICLLRLNGSAVLGPTVGLLGLPGRRAGPPTAGTWCRVAGWGFVSDFEELPPGLMEAKV
RVLDPDVCNSSWKGHLSLTMLCTRSGDSHRRGFCSADSGGPLVCRNRAHGLVSFSGLWCG
DPKTPDVYTQVSAFVAWIWDVVRRSSPQPGPLPGTTRPPGRAA
Download sequence
Identical sequences H2NWQ8
ENSPPYP00000010423 XP_009250790.1.23681 ENSPPYP00000010423 9600.ENSPPYP00000010423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]