SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010429 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010429
Domain Number 1 Region: 27-243
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.64e-60
Family Eukaryotic proteases 0.0000000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010429   Gene: ENSPPYG00000009292   Transcript: ENSPPYT00000010842
Sequence length 250
Comment pep:known_by_projection chromosome:PPYG2:19:672865:678810:1 gene:ENSPPYG00000009292 transcript:ENSPPYT00000010842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRLTVLALLAGLLAFSRAGSGPLVDIVGGRKARPRQFPFLASIQNQGRHFCGGALIHAR
FVMTAASCFRSQNPGVTVVLGAYDMRRRERRSRQTFSISSMSENGYDPQQNLNDLMLLQL
DREANLTSSVAILPLPPQNATVEAGTRCQVAGWGTQRSGGRLSRFPRLVNVTVTPEDQCR
PNNVCTGVLTRRGGICNGDGGTPLVCDGLAHGVASFSVGPCGRGPDFFTRVALFRDWIDG
VLNNPGPGPA
Download sequence
Identical sequences H2NWR4
ENSPPYP00000010429 9600.ENSPPYP00000010429 ENSPPYP00000010429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]