SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010430 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010430
Domain Number 1 Region: 17-248
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.99e-68
Family Eukaryotic proteases 0.00000000723
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010430   Gene: ENSPPYG00000009293   Transcript: ENSPPYT00000010843
Sequence length 256
Comment pep:known_by_projection chromosome:PPYG2:19:692487:699786:1 gene:ENSPPYG00000009293 transcript:ENSPPYT00000010843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHRPPSPALASVLLALLLSGAARAAEIVGGHEAQPHSRPYMASLQVRGSLGSHFCGGTL
IHPRFVLTAAHCLRDIPQHLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVL
LIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGTHDPPAQVLQELNVTVVTF
LCRPHNICTFVPRRSAGICFGDSGGPLICDGVIQGIDSFVIWGCATRHFPDFFARVALYV
DWIRSTLRRVEAEGRP
Download sequence
Identical sequences H2NWR5
ENSPPYP00000010430 9600.ENSPPYP00000010430 XP_002828407.1.23681 ENSPPYP00000010430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]