SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010431 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010431
Domain Number 1 Region: 12-247
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.57e-63
Family Eukaryotic proteases 0.00000000954
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010431   Gene: ENSPPYG00000009294   Transcript: ENSPPYT00000010844
Sequence length 267
Comment pep:known_by_projection chromosome:PPYG2:19:703909:708820:1 gene:ENSPPYG00000009294 transcript:ENSPPYT00000010844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLGRRPACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQRRGGHFCGATLI
APNFVMSAAHCVANVNPRTVQVVLGAHNLPRREPTRQVFAVQRIFENGYDPINLLNDIVI
LQLNGSATINANVQVAQLPAQGQRVGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRRAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLFPDAFAPVARFVN
WINSIIQRSEEHPCAHPRDPDPASRTH
Download sequence
Identical sequences H2NWR6
XP_009250798.1.23681 ENSPPYP00000010431 9600.ENSPPYP00000010431 ENSPPYP00000010431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]