SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010442 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010442
Domain Number 1 Region: 3-138
Classification Level Classification E-value
Superfamily Eukaryotic RPB5 N-terminal domain 5.49e-46
Family Eukaryotic RPB5 N-terminal domain 0.00024
Further Details:      
 
Domain Number 2 Region: 135-210
Classification Level Classification E-value
Superfamily RPB5-like RNA polymerase subunit 6.28e-21
Family RPB5 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010442   Gene: ENSPPYG00000009305   Transcript: ENSPPYT00000010855
Sequence length 211
Comment pep:known chromosome:PPYG2:19:999017:1006644:-1 gene:ENSPPYG00000009305 transcript:ENSPPYT00000010855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTV
LVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVD
MAPKYILEQFLQQELLINITEHEFYPSWHVTLALSSIFLTLLRSKLRENQLPRIQAGDPV
ARYFGIKRGQVVKIIRPSETAGRYITYRLVQ
Download sequence
Identical sequences H2NWS6
ENSPPYP00000010442 9600.ENSPPYP00000010442 ENSPPYP00000010442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]