SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010465 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010465
Domain Number 1 Region: 1-54
Classification Level Classification E-value
Superfamily DNA-binding domain 0.000000000000621
Family Methyl-CpG-binding domain, MBD 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010465   Gene: ENSPPYG00000009325   Transcript: ENSPPYT00000010878
Sequence length 255
Comment pep:known chromosome:PPYG2:19:1520189:1531323:-1 gene:ENSPPYG00000009325 transcript:ENSPPYT00000010878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMSKMNKIRQRVRYDSSKRTRGKPDLN
TALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWEKKLSGLNAFDIAEELV
KTMDLPKGLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEKNPGVWLNTTQPLCK
AFMVTDEDIRKQEELVQQVRKRLEEALMADMLAHVEELARDGEVPLDKACAEDDEEEDEE
DEEEEPDPDPEMEHV
Download sequence
Identical sequences H2NWU8
9600.ENSPPYP00000010465 ENSPPYP00000010465 ENSPPYP00000010465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]