SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010493 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010493
Domain Number 1 Region: 189-437
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.93e-88
Family Eukaryotic proteases 0.0000655
Further Details:      
 
Domain Number 2 Region: 763-1012
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.32e-84
Family Eukaryotic proteases 0.00017
Further Details:      
 
Domain Number 3 Region: 484-690
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.64e-63
Family Eukaryotic proteases 0.00018
Further Details:      
 
Domain Number 4 Region: 153-192
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000406
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010493   Gene: ENSPPYG00000009351   Transcript: ENSPPYT00000010906
Sequence length 1013
Comment pep:known_by_projection chromosome:PPYG2:19:2373151:2411011:1 gene:ENSPPYG00000009351 transcript:ENSPPYT00000010906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPTVADVHLVPRTTKEVPAPDAACCRAATIGVVAPSLVVLTLGVLLAFLSTQGIHVDHT
AELRGIRWASSLQRETSDYHRMLTPTLEALLHFLLRPLQTLSLGLEEELLQRGIRARLRE
HGISLAAYGTIVSAELTGRHKGPLAERDLKSGPCPGNSFSCQNSQCVTKVNPECDDQKDC
SDGSDEAHCECGLQPAWRMAGRIVGGTEASPGEFPWQASLRENKEHFCGAAIINARWLVS
AAHCFNEFQDPTEWVAYVGATYLSGWEASTVRARVAQIVKHPLYNADTADFDVAVLELTS
PLPFGRHIQPVCLPAATHIFPPRKKCLISGWGYLKEDFLVKPEVLQKATVELLDQALCAS
LYGHSLTDRMVCAGYLDGKVDSCQGDSGGPLVCEEPSGRFFLAGIVSWGIGCAEARRPGV
YARVTRLRDWILEATTKASMPLVPTVAPAPAAPSTAWPTSPESPVVSAPNKSTQAPSTVP
LDWVTVPKLQECGARPAMEKPTRVVGGFGAASGEVPWQVSLKEGSRHFCGATVVGDRWLL
SAAHCFNHTKVEQVRAHLGTASLLGLGGSPVKIGLRRVVLHPLYNPGILDFDLAVLELAS
PLAFNKYIQPVCLPLAIQKFPVGRKCMISGWGNTQEGNGDSGGPLACEEAPGVFYLAGIV
SWGIGCAQVKKPGVYTRITRLKGWILEIMSSQPLPVCPPSTTRMLATTSPRTTAGLTVLG
ATPSRPTPGAASRVTGQPANSTLSAVSTTARGQTPFLDTPEATTHSQPPDCGLAPAALTR
IVGGSAAGRGEWPWQVSLWLRRREHRCGAVLVAERWLLSAAHCFDVYGDPKQWAAFLGTP
FLSGAEGQLKRVARIYKHPFYNLYTLDYDVALLELVGPVRRSRLVRPICLPEPAPRPPDG
ARCVITGWGSVREGGSMARQLQKAAVRLLSEQTCRRFYPVQISSRMLCAGFPQGGVDSCS
GDAGGPLACREPSGRWVLIGVTSWGYGCGRPHFPGVYTRVAAVRGWIGQHIQE
Download sequence
Identical sequences H2NWX5
ENSPPYP00000010493 ENSPPYP00000010493 9600.ENSPPYP00000010493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]