SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010634 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010634
Domain Number 1 Region: 155-204
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000118
Family C-type lectin domain 0.0000753
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000010634
Domain Number - Region: 81-153
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0876
Family Mitotic arrest deficient-like 1, Mad1 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010634   Gene: ENSPPYG00000009484   Transcript: ENSPPYT00000011051
Sequence length 234
Comment pep:known_by_projection chromosome:PPYG2:19:7854388:7865020:-1 gene:ENSPPYG00000009484 transcript:ENSPPYT00000011051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEGQYSEIEELSRRRCCRRGTQIVLLGLLTAALWSGLLTLLLLWHWDTTQSLKQLEERA
ARNVSQVSKNLERHHGDQMAQKSQSTQISQDLEELRAEQQRLKSQDLELSWNLNGLQEDL
SSFKSQELNERNEASDLLERLRKEVTKLRMELQVSSNWAPGEPTSRSQGEDCVMMRGSGH
WHDAFCDRKLGTWVCDRLATCTPPASEGSAESVGPDSRPGPDGRLPAPSAPLRS
Download sequence
Identical sequences H2NXB4
ENSPPYP00000010634 ENSPPYP00000010634 9600.ENSPPYP00000010634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]