SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010635 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010635
Domain Number 1 Region: 158-292
Classification Level Classification E-value
Superfamily C-type lectin-like 1.21e-38
Family C-type lectin domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010635   Gene: ENSPPYG00000009485   Transcript: ENSPPYT00000011052
Sequence length 293
Comment pep:known_by_projection chromosome:PPYG2:19:7887245:7890411:-1 gene:ENSPPYG00000009485 transcript:ENSPPYT00000011052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTTRYSKWGGSSEEVPGGPWGRWVHWSRRPLFLALAVLVATVLWAVILSILLSSASTER
AALLDGQDLLRTNASKQTAALGALKEEVGDCHSCCSGTQAQLQTTRAELGEAQAKLMEQE
SALQELRERVTQGLAEAGRDREDVRTELFRALEAVRLQNNSCEPCPTSWLSFEGSCYFFS
VPKTTWAAAQGHCADASAHLVIVGGLDEQGFLTRNTRGRGYWLGLRAVRHLGKVQGYQWV
DGVSLSFSHWNQGEPNDAWGRENCVMMLHTGLWNDAPCDSEKDGWICEKRRNC
Download sequence
Identical sequences H2NXB5
XP_002828608.1.23681 9600.ENSPPYP00000010635 ENSPPYP00000010635 ENSPPYP00000010635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]