SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010641 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010641
Domain Number 1 Region: 131-302
Classification Level Classification E-value
Superfamily C-type lectin-like 1.92e-49
Family C-type lectin domain 0.0000000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010641   Gene: ENSPPYG00000009487   Transcript: ENSPPYT00000011058
Sequence length 306
Comment pep:known_by_projection chromosome:PPYG2:19:7931980:7937726:1 gene:ENSPPYG00000009487 transcript:ENSPPYT00000011058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDSKEPRVQQLDLLEEDPTTSGIRLFPRDFQFQQIHGHKSSTGCLGHGALVLQLLSFTL
LAGVLVAILVQVYKVPSSLSQEQSEQDTIYQNLTQIKAAVGELSEKSKLQEIYQELTQLK
AAVGELPEKSKLQEIYQELTQLKAALGELPDQSKQQQIYQELTDLKTAFERLCCHCPKDT
FFQGNCYFMSNSQRNWHDSVTACQEVRAQLVIIKSAEEQNFLQLQTLRSNRFSWMGLSDL
NQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCNVDNYWICKKPA
ACFRDE
Download sequence
Identical sequences H2NXC1
9600.ENSPPYP00000010641 ENSPPYP00000010641 ENSPPYP00000010641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]