SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010643 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010643
Domain Number 1 Region: 27-73
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000000595
Family C-type lectin domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010643   Gene: ENSPPYG00000009488   Transcript: ENSPPYT00000011060
Sequence length 74
Comment pep:novel chromosome:PPYG2:19:7957467:7961159:1 gene:ENSPPYG00000009488 transcript:ENSPPYT00000011060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
THGLAEAGRDREDVSTELYRALEAVRLQNSEGSCEPCPTSWLPFGDSCYYFSVPKTTWAE
AHDHCADASAHLVM
Download sequence
Identical sequences H2NXC3
9600.ENSPPYP00000010643 ENSPPYP00000010643 ENSPPYP00000010643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]