SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010935 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010935
Domain Number 1 Region: 150-267
Classification Level Classification E-value
Superfamily C-type lectin-like 2.02e-37
Family Link domain 0.002
Further Details:      
 
Domain Number 2 Region: 268-362
Classification Level Classification E-value
Superfamily C-type lectin-like 5.57e-29
Family Link domain 0.003
Further Details:      
 
Domain Number 3 Region: 1048-1146
Classification Level Classification E-value
Superfamily C-type lectin-like 1.46e-18
Family C-type lectin domain 0.00085
Further Details:      
 
Domain Number 4 Region: 44-157
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000315
Family V set domains (antibody variable domain-like) 0.021
Further Details:      
 
Domain Number 5 Region: 1013-1054
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000215
Family EGF-type module 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010935   Gene: ENSPPYG00000009763   Transcript: ENSPPYT00000011361
Sequence length 1159
Comment pep:known_by_projection chromosome:PPYG2:19:19636847:19672193:1 gene:ENSPPYG00000009763 transcript:ENSPPYT00000011361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGATFVWALGLLMLQMLLFVAGEQGTQDIADASERGLHMQKLGSGSVRAALAELVALPCL
FTLQPRPSAAQDAPRIKWTKVRTASGQRQDLPILVAKDNVVRVAKSWQGRVSLPSYPRRR
ANATLLLGPLRASDSGLYRCQVVRGIEDEQDLVPLEVTGVVFHYRAARDRYALTFTEAQE
ACRLSSAIIAAPRHLQAAFEDGFDNCDAGWLSDRTVRYPITQSRPGCYGDRSSLPGVRSY
GRRNPQELYDVYCFARELGGEVFYVGPARRLTLAGARAQCRRQGAALASVGQLHLAWHEG
LDQCDPGWLADGSVRYPIQTPRRRCGGPAPGVRTVYRFANRTGFPSPAERFDAYCFRAHH
PTSQHGDLETPSSGDEGEILSAEGPPVRELEPTLEEEEVVTPDFQEPLVSSGEEEPLILE
EKQESQQTLSPTPGDPMLASWPTGEVWLSTVAPSPSDMGAGSAASSHTEVAPTDPTPRRR
GRFKGLNGRYFQQQEPELELQSGMEASAQPPTSEAAGNQMEPPLAMAVTEMLGSGQSRSP
WADLTNEVDMPGAGSAGGKSSPEPWLWPPTMVPPSISGHSSAPVLELEKAEGPVARPATP
DLFWSPLEATVSAPSPAPWEAFPVATSPDLPMMAMLRGPKEWMLPHPTPISTEANRVEAH
GEATATAPPSPAAETKVYSLPPSSTPTGQGGEAMPTTPVSPRADFRETEETSPFQVNKAE
HSSASPWPSANRNVAVGFVPTETATVTATEPTGLRGISGSESGIFNTAESPTSGLQATVD
EVQDPWPSVYSKGLDASSPSAPLGTPGVFLVPKVTPSLEPWVATDEGPTVNLTDSTVTPA
PSDASGIWEPGSQVFEEAESTILSPRVALDTSIVTPLTTLEQGDKVGVPAMSTLGSSSSQ
PHPEPEDQVETQGTSGALAPPHQSSPLGKPAVPSGTPTAAGVGESASVSSGEPTVPWDPS
STLLPVTLGIEDFELEVLAGSPGVESFWEEVASGEEPALPGTPTNAGVEEVHSDPCENNP
CLHGGTCNANGTMYGCSCDQGFAGENCEIDIDDCLCSPCENGGTCIDEVNGFVCLCLPSY
GGSLCEKDTEGCDRGWHKFQGHCYRYFAHRRAWEDAERDCRRRSGHLTSVHSPEEHGFIN
SRGSGEGATCLEGGQAWHL
Download sequence
Identical sequences H2NY56
ENSPPYP00000010935 ENSPPYP00000010935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]