SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010936 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010936
Domain Number 1 Region: 162-281
Classification Level Classification E-value
Superfamily C-type lectin-like 1.58e-38
Family Link domain 0.0018
Further Details:      
 
Domain Number 2 Region: 284-366
Classification Level Classification E-value
Superfamily C-type lectin-like 4.24e-24
Family Link domain 0.0038
Further Details:      
 
Domain Number 3 Region: 48-161
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000245
Family V set domains (antibody variable domain-like) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010936   Gene: ENSPPYG00000009764   Transcript: ENSPPYT00000011362
Sequence length 402
Comment pep:known_by_projection chromosome:PPYG2:19:19679621:19686847:-1 gene:ENSPPYG00000009764 transcript:ENSPPYT00000011362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCARAALGPGALWAAAWGVLLLTAPAGAQRGRKKVVHVLEGESGSVVVQTAPGQVVSHR
GGTIVLPCRYHYEAAAHGHDGVRLKWTKVVDPLAFTDVFVALGPQHRAFGSYRGRAELQG
DGPGDASLVLRNVTLQDYGRYECEVTNELEDDAGMVKLDLEGVVFPYHPRGGRYKLTFAE
AQRACAEQDGILASAEQLHAAWRDGLDWCNAGWLRDGSVQYPVNRPREPCGGLGGTGSAG
GGGDANGGVRNYGYRHNAEERYDAFCFTSNLPGRVFFLKPLRPVPFSGAARACAARGAAV
AKVGQLFAAWKLQLLDRCTAGWLADGSARYPIVNPRARCGGRRPGVRSLGFPDATRRLFG
VYCYRAPGAPDPAPGGWGWGWAGGGGWAGGARDPAAWTPLRV
Download sequence
Identical sequences H2NY57
ENSPPYP00000010936 9600.ENSPPYP00000010936 ENSPPYP00000010936 XP_002829008.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]