SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011000 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000011000
Domain Number - Region: 128-195
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000428
Family Link domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011000   Gene: ENSPPYG00000009824   Transcript: ENSPPYT00000011429
Sequence length 904
Comment pep:known_by_projection chromosome:PPYG2:19:33637985:33712057:1 gene:ENSPPYG00000009824 transcript:ENSPPYT00000011429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARDSDSEEDLVSYGTGLEPLEEGERPKKPIPLQDQTVRDEKGRYKRFHGAFSGGFSAG
YFNTVGSKEGWTPSTFVSSRQNRADKSVLGPEDFMDEEDLSEFGIAPKAIVTTDDFSSKT
KDRIREKARQLAAATAPIPGATLLDDLITPAKLSVGFELLRKMGWKEGQGVGPRVKRRPR
RQKPDPGVKIYGCALPPGSSEGSEGEDDDYLPDNVTFAPKDVTPVDFTPKDNVHGLAYKG
LDPHQALFGTSGEHFNLFSGGSERAGDLGEIGLNKGRKLGISGQAFGVGALEEEDDDIYA
TETLSKYDTVLRDEEPGDGLYGWTAPRQYKNQKIYPPPELPRDYRPVHYFRPMVAATSEN
SHLLQVLSESAGKATPDLGTHSKHQLNASKRAELLGETPIQGSATSVLEFLSQKDKERIK
EMKQATDLKAAQLKARSLAQNAQSSRAQPSPAAAAGHCSWHMALGGGTATLKASNFKPFA
KDPEKQKRYEEFLVHMKQGQKDALERCLDPSMTEWERGRERDEFARAALLYASSHSTLSS
RFTHAKEEDDSDQVEVPRDQENDVRDKQSAVKMKMFGKLTRDTFEWHPDKLLCKRFNVPD
PYPDSTLVGLPRVKRDKYSVFNFLTLPETASLSTTQASSEKVSQHRGPDKSRKPSRWDTS
KHEKKEDSISEFLSLARSKAGPPKQESSPLVNKEEECAPESSANQTVNKGVDAQAEGEGS
RPSMDLFRAIFASSSDEKSSSSEDEQDDSEDDQAGSGEANFQSSQDTDLGETSSMARTLV
PAPQEPPPSFPIQKMQIDEREEFGPRLPPVFCPNARQTLEVPQKEKHKKNKDKHKAKKEH
RRKKEKKKKHRKHKHKGKQKNKKTEKSSSSESSDSSDSQSDEETADVSPQELLRRLKSLP
LRRQ
Download sequence
Identical sequences H2NYC0
ENSPPYP00000011000 ENSPPYP00000011000 9600.ENSPPYP00000011000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]