SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011026 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011026
Domain Number 1 Region: 163-405
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.04e-86
Family Eukaryotic proteases 0.0000000037
Further Details:      
 
Domain Number 2 Region: 51-157
Classification Level Classification E-value
Superfamily SRCR-like 5.75e-16
Family Hepsin, N-terminal domain 0.00000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011026   Gene: ENSPPYG00000009847   Transcript: ENSPPYT00000011456
Sequence length 417
Comment pep:known chromosome:PPYG2:19:35790571:35819588:1 gene:ENSPPYG00000009847 transcript:ENSPPYT00000011456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQKEGGRTVPCCSRPKVAALTAGTLLLLTAIGAASWAIVAVLLRSDQEPLYPVQVSSAD
ARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCV
DEGRLPHTQRLLEVISVCDCPRGRFLATICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSL
RYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLAVQAVVYH
GGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQ
YYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCE
DSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL
Download sequence
Identical sequences H2NYE5
ENSPPYP00000011026 9600.ENSPPYP00000011026 ENSPPYP00000011026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]