SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011347 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011347
Domain Number 1 Region: 185-286
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.23e-23
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0000571
Further Details:      
 
Domain Number 2 Region: 37-100
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000236
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011347   Gene: ENSPPYG00000010147   Transcript: ENSPPYT00000011789
Sequence length 613
Comment pep:known_by_projection chromosome:PPYG2:19:47631284:47677232:1 gene:ENSPPYG00000010147 transcript:ENSPPYT00000011789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLTISYLRMHRLCAAGEWNQVRAGGEPLDACYLKALEGFVMVLTAEGDMAYLSENVSKH
LGLSQLELIGHSIFDFIHPCDQEELQDALTPQQTLSRRKVEAPTERCFSLRMKSTLTSRG
RTLNLKAATWKVLHCSGHMRAYKPPAQTSPAGSPDSEPPLQCLVLICEAIPHPGSLEPPL
GRGAFLSRHSLDMKFTYCDDRIAEVAGYSPDDLIGCSAYEYIHALDSDAVSKSIHTLLSK
GQAVTGQYRFLARSGGYLWTQTQATVVSGGRGPQSESIVCVHFLISQVEETEVVLSLEQT
EQHSRRPIQQGAPSQKDTPNPGDSLDAPGPQILAFLHPPSLSEAALAADPRRFCSPDLRR
LLGPILDGASVVATPSTPLATRRPQSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDL
DIAQDADALDLEMLAPYISMDDDFQLNASEQLPRAYHRPLGAVPRPRARSFHGLSPPALE
PSLLPRWGSDPRLSCSSPSRGDPSASSPMAGARKRTLAQSSEDEDEGMELLGVRPPKRSP
SPEHENFLLFPLSLSFLLTGGPAPGSLQDPSTPLLNLNEPLGLGPSLLSPYSDEDTTQPG
GPFQPRAGSAQAD
Download sequence
Identical sequences H2NZB2
ENSPPYP00000011347 ENSPPYP00000011347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]