SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011474 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011474
Domain Number 1 Region: 25-487
Classification Level Classification E-value
Superfamily ALDH-like 4.06e-91
Family ALDH-like 0.00000383
Further Details:      
 
Domain Number 2 Region: 507-768
Classification Level Classification E-value
Superfamily ALDH-like 2.88e-43
Family ALDH-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011474   Gene: ENSPPYG00000010249   Transcript: ENSPPYT00000011916
Sequence length 802
Comment pep:known_by_projection chromosome:PPYG2:19:51038650:51057326:1 gene:ENSPPYG00000010249 transcript:ENSPPYT00000011916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATRAGPRAREIFTSLEYGPVPESHACALAWLDTQDRCLGHCVNGKWLKPEHRNSVPCQ
DPITGENLASCLQAQAEDVAAAVEAARMAFKSWSVQPGVVRAQHLTRLAKVIQKHQRLLW
TLESLVTGRAVREVREGDVQLAQQLLHYYAIQASTQEEALAGWEPMGVIGLILPPTFSFL
EMMWRICPALAVGCTVVALVPPASPTPLLLAQLSGELGPFPGILNVISGPVSLVPVLASQ
PGIQKVAFCGALEEGRALRRSLAGECAELGLALGTESLLLLTDTADIDSAVEGVVDAAWS
DRGPGGLRLLIQESVWDEAMRRLQERMGRLRSGRGLDGAVDMGARGAAACDLVQRFVREA
QSQGAQVFQAGDVPSERPFYPPTLVSNLPPASPCAQVEVPWPVVVASPFRTAKEALLVAN
GTPRGGSASVWSERLGQALELGYGLQVGTVWINAHGLRDPSVPTGGCKESGCSWHGGPDG
LYEYLRPSGTPARLSCLSKNLNYDTFGLAVPSTLPAGPEIGPSPAPPYGLFVGGRFQAPG
AQSSRPIQDSSGNLHGYMAEGGAKDIRGAVEAAHQAFPGWAGQSPGARASLLWALAAALE
RRKSTLASRLERQGVELKAAEAEVELSARRLRAWGARAQAQGHTLQVAGLRGPVLRLREP
LGVLAVVCPDEWPLLAFVSLLAPALAYGNTVVMVPSAACPLLALEVCQDMATLFPAGLAN
VVTGDQDHLTRCLALHQDVQAMWYFGSAQGSQFVEWASAGNLKPVWASRGCLRAWDQEAE
GAGPELGLRAARTKALWLPMGD
Download sequence
Identical sequences H2NZN1
9600.ENSPPYP00000011474 XP_002829599.1.23681 ENSPPYP00000011474 ENSPPYP00000011474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]