SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011522 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011522
Domain Number 1 Region: 179-322
Classification Level Classification E-value
Superfamily C-type lectin-like 3.15e-24
Family C-type lectin domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011522   Gene: ENSPPYG00000010291   Transcript: ENSPPYT00000011965
Sequence length 323
Comment pep:known_by_projection chromosome:PPYG2:19:52286957:52289289:1 gene:ENSPPYG00000010291 transcript:ENSPPYT00000011965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAAWLLGALVVPQLLGFGHGARGAEREWEGGWGGAQEEEREREALMLKHLQEALGLPAG
RGDENPAGTVEGKEDWEMEEDQGEEEEEEATPTPSSGPSPSPTPEDIVTYILGRLAGLDA
GLHQLHVRLHALDTRVVELTQELRQLRNAAGDTRDAVQALQEAQGRAEREHGRLEGCLKG
LRLGHKCFLLSRDFEAQAAAQARCTARGGSLAQPADRQQMEALTRYLRAALAPYNWPVWL
GVHDRRAEGLYLFENGQRVSFFAWHRSPRPELGAQPSASPHPLSPDQPNGGTLENCVAQA
SDDGSWWDHDCQRRLYYVCEFPF
Download sequence
Identical sequences H2NZS9
ENSPPYP00000011522 ENSPPYP00000011522 XP_002829665.1.23681 9600.ENSPPYP00000011522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]